SKU: 20345616621
Ships within 48 hours · Estimated delivery Oct 31 - Nov 5
glutathione peroxidase 6 Glucose-6-phosphate Dehydrogenase (G6PD) Enzyme Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus
EuRho Vital L-Glutathion plus NAC & Vit C | EuRho Vital
Synonyms : NN0174-0833, AM833, EX‑A10092 Product Specifications CAS Number : 1415456‑99‑3 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Weight : 4409 g/mol Chemical Formula : C₁₉₄H₃₁₂N₅₄O₅₉S₂ Purity : Typically supplied at ≥98% purity by HPLC
Muscle Health
Quantity:1 PCS
In vitro analysis of primary endothelial cells lacking GPx1 finds that they also manifest increased oxidative stress
US$ 23.37
US$ 29.40
US$ 26.06
