SKU: 28181985850
Ships within 48 hours · Estimated delivery Oct 30 - Nov 4
glutathione peroxidase 6 4: a new player in neurodegeneration? Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus
EuRho Vital L-Glutathion plus NAC & Vit C | EuRho Vital
Synonyms : NN0174-0833, AM833, EX‑A10092 Product Specifications CAS Number : 1415456‑99‑3 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Weight : 4409 g/mol Chemical Formula : C₁₉₄H₃₁₂N₅₄O₅₉S₂ Purity : Typically supplied at ≥98% purity by HPLC
Muscle Health
Quantity:1 PCS
In vitro analysis of primary endothelial cells lacking GPx1 finds that they also manifest increased oxidative stress
US$ 20.97
US$ 21.50
US$ 26.74
US$ 26.31
US$ 22.80
US$ 26.50
US$ 29.22
US$ 22.14
US$ 23.94
US$ 26.11
US$ 26.49
US$ 22.28
US$ 20.50
