SKU: 43077879734
Ships within 48 hours · Estimated delivery Nov 5 - Nov 10
glutathione peroxidase 6 Elisa Kit for Rat (GPX) Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus
EuRho Vital L-Glutathion plus NAC & Vit C | EuRho Vital
Synonyms : NN0174-0833, AM833, EX‑A10092 Product Specifications CAS Number : 1415456‑99‑3 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Weight : 4409 g/mol Chemical Formula : C₁₉₄H₃₁₂N₅₄O₅₉S₂ Purity : Typically supplied at ≥98% purity by HPLC
Muscle Health
Quantity:1 PCS
In vitro analysis of primary endothelial cells lacking GPx1 finds that they also manifest increased oxidative stress
US$ 28.15
US$ 26.78
US$ 29.27
US$ 21.85
US$ 28.30
/assets/images/provider/photos/2787796.jpeg)
