SKU: 45298908833
Ships within 48 hours · Estimated delivery Oct 27 - Nov 1
glutathione peroxidase 6 Frontiers Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus
EuRho Vital L-Glutathion plus NAC & Vit C | EuRho Vital
Synonyms : NN0174-0833, AM833, EX‑A10092 Product Specifications CAS Number : 1415456‑99‑3 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Weight : 4409 g/mol Chemical Formula : C₁₉₄H₃₁₂N₅₄O₅₉S₂ Purity : Typically supplied at ≥98% purity by HPLC
Muscle Health
Quantity:1 PCS
In vitro analysis of primary endothelial cells lacking GPx1 finds that they also manifest increased oxidative stress
US$ 27.64
US$ 26.09
US$ 28.76
US$ 25.19
US$ 22.85
US$ 23.27
US$ 21.82
US$ 25.50
