SKU: 67147076008
Ships within 48 hours · Estimated delivery Oct 27 - Nov 1
glutathione peroxidase 6 GPX6 Recombinant Protein; 6; Human; MyBioSource Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus
EuRho Vital L-Glutathion plus NAC & Vit C | EuRho Vital
Synonyms : NN0174-0833, AM833, EX‑A10092 Product Specifications CAS Number : 1415456‑99‑3 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Weight : 4409 g/mol Chemical Formula : C₁₉₄H₃₁₂N₅₄O₅₉S₂ Purity : Typically supplied at ≥98% purity by HPLC
Muscle Health
Quantity:1 PCS
In vitro analysis of primary endothelial cells lacking GPx1 finds that they also manifest increased oxidative stress
US$ 29.88
:max_bytes(150000):strip_icc()/benefits-of-glutathione-89457_final-01-502464fe91b2444285b0cccf8cb0a33c.png)
US$ 23.54
US$ 24.35
US$ 21.43
US$ 21.49
