SKU: 88995893834
Ships within 48 hours · Estimated delivery Oct 30 - Nov 4
glutathione peroxidase 6 The Role of Peroxidase-1 in Health and Disease Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus
EuRho Vital L-Glutathion plus NAC & Vit C | EuRho Vital
Synonyms : NN0174-0833, AM833, EX‑A10092 Product Specifications CAS Number : 1415456‑99‑3 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Weight : 4409 g/mol Chemical Formula : C₁₉₄H₃₁₂N₅₄O₅₉S₂ Purity : Typically supplied at ≥98% purity by HPLC
Muscle Health
Quantity:1 PCS
In vitro analysis of primary endothelial cells lacking GPx1 finds that they also manifest increased oxidative stress
US$ 26.94
US$ 25.70
US$ 28.17
US$ 25.11
US$ 23.82
US$ 26.14
US$ 23.57
US$ 24.74
US$ 24.95
US$ 20.96
US$ 24.47
US$ 25.96
