glutathione peroxidase 6 The Role of Peroxidase-1 in Health and Disease Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus

Name: glutathione peroxidase 6 The Role of Peroxidase-1 in Health and Disease Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus
Brand: technospeak.fr
SKU: 88995893834
Price: 27.94 USD
Availability: InStock
Rating: 4.4176 (10 reviews)

SKU: 88995893834

Dispatch

Shipping Estimate
USA

USA

CAN

Ships within 48 hours · Estimated delivery Nov 1 - Nov 6

Description

glutathione peroxidase 6 The Role of Peroxidase-1 in Health and Disease Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus

EuRho Vital L-Glutathion plus NAC & Vit C | EuRho Vital

Synonyms : NN0174-0833, AM833, EX‑A10092 Product Specifications CAS Number : 1415456‑99‑3 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Weight : 4409 g/mol Chemical Formula : C₁₉₄H₃₁₂N₅₄O₅₉S₂ Purity : Typically supplied at ≥98% purity by HPLC

Muscle Health

Quantity:1 PCS

In vitro analysis of primary endothelial cells lacking GPx1 finds that they also manifest increased oxidative stress

Exchange/Return Notes