glutathione peroxidase 6 Peroxiredoxin maintains mitochondrial homeostasis and promotes tumor progression through ROS/JNK/p38 MAPK signaling pathway in multiple myeloma Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus

glutathione peroxidase 6 Peroxiredoxin maintains mitochondrial homeostasis and promotes tumor progression through ROS/JNK/p38 MAPK signaling pathway in multiple myeloma Quantity:1 PCS Muscle Health EuRho Vital L-Glutathion plus

EuRho Vital L-Glutathion plus NAC & Vit C | EuRho Vital

Synonyms : NN0174-0833, AM833, EX‑A10092 Product Specifications CAS Number : 1415456‑99‑3 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Weight : 4409 g/mol Chemical Formula : C₁₉₄H₃₁₂N₅₄O₅₉S₂ Purity : Typically supplied at ≥98% purity by HPLC

Muscle Health

Quantity:1 PCS

In vitro analysis of primary endothelial cells lacking GPx1 finds that they also manifest increased oxidative stress